Structure of PDB 6n8o Chain O

Receptor sequence
>6n8oO (length=136) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAG
VPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKK
IAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA
3D structure
PDB6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
ChainO
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O K8 W12 R13 K42 N59 R74 G75 R77 T78 A79 T80 K83 W99 R106 R109 M121 R124 Q126 R128 Y129 K132 K133 K6 W10 R11 K40 N57 R72 G73 R75 T76 A77 T78 K81 W97 R104 R107 M119 R122 Q124 R126 Y127 K130 K131
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016236 macroautophagy
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum6n8o
PubMed30814529
UniProtP36105|RL14A_YEAST Large ribosomal subunit protein eL14A (Gene Name=RPL14A)

[Back to BioLiP]