Structure of PDB 6gym Chain O |
>6gymO (length=180) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG KIVLTGAKQREEIYQAFEAIYPVLSEFRKM |
|
PDB | 6gym Promoter Distortion and Opening in the RNA Polymerase II Cleft. |
Chain | O |
Resolution | 6.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0001188 |
RNA polymerase I preinitiation complex assembly |
GO:0006352 |
DNA-templated transcription initiation |
GO:0006359 |
regulation of transcription by RNA polymerase III |
GO:0042790 |
nucleolar large rRNA transcription by RNA polymerase I |
GO:0045892 |
negative regulation of DNA-templated transcription |
GO:0045944 |
positive regulation of transcription by RNA polymerase II |
GO:0051123 |
RNA polymerase II preinitiation complex assembly |
GO:0070898 |
RNA polymerase III preinitiation complex assembly |
|
|