Structure of PDB 6gym Chain O

Receptor sequence
>6gymO (length=180) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
3D structure
PDB6gym Promoter Distortion and Opening in the RNA Polymerase II Cleft.
ChainO
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna O F99 F116 S118 K120 N159 R196 T215 F39 F56 S58 K60 N99 R136 T155
BS02 dna O Q68 N69 R98 F99 R105 T112 T124 F207 K211 Q8 N9 R38 F39 R45 T52 T64 F147 K151
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001016 RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0001092 TFIIA-class transcription factor complex binding
GO:0001179 RNA polymerase I general transcription initiation factor binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0097718 disordered domain specific binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gym, PDBe:6gym, PDBj:6gym
PDBsum6gym
PubMed30472190
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]