Structure of PDB 6g4s Chain O

Receptor sequence

>6g4sO (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]

LGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADR
DESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSAL
RALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL

3D structure

PDB

6g4s Visualizing late states of human 40S ribosomal subunit maturation.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	G49 K50 G59 D65 P134 I135 P136 S137 R142 K143 R146	G33 K34 G43 D49 P118 I119 P120 S121 R126 K127 R130

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045182	translation regulator activity
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0030218	erythrocyte differentiation
GO:0030490	maturation of SSU-rRNA
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0014069	postsynaptic density
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6g4s, PDBe:6g4s, PDBj:6g4s
PDBsum	6g4s
PubMed	29875412
UniProt	P62263\|RS14_HUMAN Small ribosomal subunit protein uS11 (Gene Name=RPS14)