Structure of PDB 6fyy Chain O

Receptor sequence

>6fyyO (length=129) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

DNSQVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDESSPY
AAMLAAQDVAAKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRALARS
GLRIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

• PDB: 6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: O
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	R18 F20 N24 D25 F27 H29 G35 R36 E37 T38 R41 T43 G45 M46 A50 D51 R52 E54 R84 G88 P120 V121 P122 S123 D124 S125 T126 R127 K129 G130 G131 R132 R133 R135 R136	R10 F12 N16 D17 F19 H21 G27 R28 E29 T30 R33 T35 G37 M38 A42 D43 R44 E46 R76 G80 P112 V113 P114 S115 D116 S117 T118 R119 K121 G122 G123 R124 R125 R127 R128

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
• PDBsum: 6fyy
• PubMed: 30475211
• UniProt: P27069|RS14_KLULA Small ribosomal subunit protein uS11 (Gene Name=RPS14)