Structure of PDB 6dzk Chain O

Receptor sequence
>6dzkO (length=88) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHH
SRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR
3D structure
PDB6dzk Zinc depletion induces ribosome hibernation in mycobacteria.
ChainO
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O A2 K8 T20 D21 T22 G23 Q28 R35 H42 H46 H48 H50 H51 R54 R65 K68 Y69 A1 K7 T19 D20 T21 G22 Q27 R34 H41 H45 H47 H49 H50 R53 R64 K67 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzk, PDBe:6dzk, PDBj:6dzk
PDBsum6dzk
PubMed30038002
UniProtA0QVQ3|RS15_MYCS2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]