Structure of PDB 6dzi Chain O

Receptor sequence

>6dziO (length=118) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PKPTKGPRLGGSSSHQSALLANLATSLFEHGRIKTTEPKARALRPYAEKL
ITHAKKGALHNRREVMKKIRDKDVVHTLFAEIGPFYADRNGGYTRIIKVE
NRKGDNAPMAVIELVREK

3D structure

• PDB: 6dzi Zinc depletion induces ribosome hibernation in mycobacteria.
• Chain: O
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	P2 P4 K6 G7 P8 R9 G12 H16 K35 P39 K40 R42 R45 E49 K50 L60 H61 R63 R64 E65 M67 K68 K73 H77 R90 G92 G93 T95 R96 R103 G105 D106 N107	P1 P3 K5 G6 P7 R8 G11 H15 K34 P38 K39 R41 R44 E48 K49 L59 H60 R62 R63 E64 M66 K67 K72 H76 R89 G91 G92 T94 R95 R102 G104 D105 N106

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6dzi, PDBe:6dzi, PDBj:6dzi
• PDBsum: 6dzi
• PubMed: 30038002
• UniProt: A0QSL9|RL17_MYCS2 Large ribosomal subunit protein bL17 (Gene Name=rplQ)