Structure of PDB 5zeb Chain O

Receptor sequence

>5zebO (length=117) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PKPTKGPRLGGSSSHQSALLANLATSLFEHGRIKTTEPKARALRPYAEKL
ITHAKKGALHNRREVMKKIRDKDVVHTLFAEIGPFYADRNGGYTRIIKVE
NRKGDNAPMAVIELVRE

3D structure

• PDB: 5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
• Chain: O
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	P2 K3 P4 T5 K6 G7 P8 R9 S14 H16 A19 L21 N23 I34 K35 T36 T37 P39 K40 R45 K50 T53 K57 L60 H61 R63 R64 M67 K68 R71 K73 D74 H77 R90 N91 G92 G93 T95 R96 K99 R103 K104 G105 D106 N107 A108	P1 K2 P3 T4 K5 G6 P7 R8 S13 H15 A18 L20 N22 I33 K34 T35 T36 P38 K39 R44 K49 T52 K56 L59 H60 R62 R63 M66 K67 R70 K72 D73 H76 R89 N90 G91 G92 T94 R95 K98 R102 K103 G104 D105 N106 A107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
• PDBsum: 5zeb
• PubMed: 30206241
• UniProt: A0QSL9|RL17_MYCS2 Large ribosomal subunit protein bL17 (Gene Name=rplQ)