Structure of PDB 5z3g Chain O

Receptor sequence
>5z3gO (length=190) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NSNEPPKIFLTTNVNAKKSAYEFANILIEILPNVTFVKRKFGYKLKEISD
ICIKRNFTDIVIINEDKKKVTGLTFIHEGPTFYFKLSSIPELILNNFQTR
LGQTVGRLFQSILPQNPDIEGRQVITLHNQRDYIFFRRHRYVFKDNERVG
LQELGPQFTLKLKRLQRGIKEETEWEHKPEMDKEKKKFYL
3D structure
PDB5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
ChainO
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O K105 Y108 K125 F128 G129 K154 R245 P284 K288 K18 Y21 K38 F41 G42 K67 R140 P179 K183
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum5z3g
PubMed29557065
UniProtP38805|RPF1_YEAST Ribosome production factor 1 (Gene Name=RPF1)

[Back to BioLiP]