Structure of PDB 5wcu Chain O

Receptor sequence
>5wcuO (length=97) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5wcu Revisit of Reconstituted 30-nm Nucleosome Arrays Reveals an Ensemble of Dynamic Structures.
ChainO
Resolution5.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna O Y41 P43 G44 T45 V46 A47 R49 R63 K64 L65 P66 R69 Y4 P6 G7 T8 V9 A10 R12 R26 K27 L28 P29 R32
BS02 dna O Y41 R42 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 Y4 R5 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wcu, PDBe:5wcu, PDBj:5wcu
PDBsum5wcu
PubMed29959925
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]