Structure of PDB 5v7q Chain O

Receptor sequence
>5v7qO (length=116) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
ATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVA
AASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGG
RIAALADAARENGLSF
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainO
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R15 R16 T18 R19 K22 L24 F97 R99 Y104 R116 F122 R9 R10 T12 R13 K16 L18 F91 R93 Y98 R110 F116
BS02 rna O R9 R10 R13 H17 R21 R32 R37 S38 H41 Q45 V47 T54 I61 D71 K73 Y102 T103 G106 R107 R3 R4 R7 H11 R15 R26 R31 S32 H35 Q39 V41 T48 I55 D65 K67 Y96 T97 G100 R101
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WHD1|RL18_MYCTU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]