Structure of PDB 5t2a Chain O

Receptor sequence

>5t2aO (length=203) Species: 5661 (Leishmania donovani)

GAFMYLNELWKKKSSDVMRFIQRIRSWEFRHQHTVVRLRRPTRPEKARML
GYKTKQGFCVFRVRVRRGGRKRPVHKGITYGKPKTSGVLGMKLNKNNQAV
AEQRLGKRFGNLRVLNSYWVNMDSTFKWYEVIAVDPMCKTIRRDPRINWI
VNSVHKHREQRGLTSAGRKHRGLRHKGHKASKLRPSYRAAWRRNNRIVFL
RKR

3D structure

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Chain: O
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	G2 F4 K12 K14 S15 H34 R40 R41 R44 R49 M50 K54 T55 R67 R68 G69 G70 R71 H76 Y81 G82 K83 P84 K85 M92 K93 L94 N95 K96 N97 N98 R105 G111 N112 W120 M138 K140 T141 R144 R147 W150 S154 H156 K157 Q161 R162 L164 S166 R169 K170 H171 R172 R175 H176 K177 G178 H179 K180 S182 K183 R185 S187 Y188 A190 W192 R193 R194 N195 F200 R202 R204	G1 F3 K11 K13 S14 H33 R39 R40 R43 R48 M49 K53 T54 R66 R67 G68 G69 R70 H75 Y80 G81 K82 P83 K84 M91 K92 L93 N94 K95 N96 N97 R104 G110 N111 W119 M137 K139 T140 R143 R146 W149 S153 H155 K156 Q160 R161 L163 S165 R168 K169 H170 R171 R174 H175 K176 G177 H178 K179 S181 K182 R184 S186 Y187 A189 W191 R192 R193 N194 F199 R201 R203
BS02	rna	O	R24 W28 R67 K72 P74 H76 K77 I79 G82 S87 V89 L90 S125 T126	R23 W27 R66 K71 P73 H75 K76 I78 G81 S86 V88 L89 S124 T125
BS03	rna	O	R38 Q57 C60 F62 F110 N112 D136	R37 Q56 C59 F61 F109 N111 D135

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
• PDBsum: 5t2a
• PubMed: 27752045
• UniProt: E9BMB4