Structure of PDB 5nfy Chain O |
>5nfyO (length=133) Species: 229992 (SARS coronavirus Frankfurt 1) [Search protein sequence] |
HHAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTH TGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQ IPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCD |
|
PDB | 5nfy Structural and molecular basis of mismatch correction and ribavirin excision from coronavirus RNA. |
Chain | O |
Resolution | 3.382 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
O |
H83 C90 |
H85 C92 |
|
|
|
|