Structure of PDB 5mlc Chain O

Receptor sequence

>5mlcO (length=135) Species: 3562 (Spinacia oleracea)

MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAG
RRAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPG
RILYEISGVAENIARRAVAIAASKMPIRTQFIISG

3D structure

• PDB: 5mlc Cryo-EM structure of the spinach chloroplast ribosome reveals the location of plastid-specific ribosomal proteins and extensions.
• Chain: O
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	K5 R6 R8 F9 K11 Q12 H13 R14 G15 R16 M17 K18 R23 C28 W41 R45 Q46 R67 F69 V76 R77 E80 R82 M83 G84 S85 G86 K87 R101 S123 K124 P126	K5 R6 R8 F9 K11 Q12 H13 R14 G15 R16 M17 K18 R23 C28 W41 R45 Q46 R67 F69 V76 R77 E80 R82 M83 G84 S85 G86 K87 R101 S123 K124 P126
BS02	rna	O	R16 M17 G19 E38	R16 M17 G19 E38

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0009507 chloroplast
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5mlc, PDBe:5mlc, PDBj:5mlc
• PDBsum: 5mlc
• PubMed: 27986857
• UniProt: P17353|RK16_SPIOL Large ribosomal subunit protein uL16c (Gene Name=rpl16)