Structure of PDB 5li0 Chain O

Receptor sequence
>5li0O (length=131) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGF
EGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESG
VVKNEKSGIKILGNGSLDKKLTVKAHKFSAS
3D structure
PDB5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
ChainO
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O L3 H4 L6 G11 R13 E15 R18 G20 R21 G22 K29 T30 G32 H35 G37 K39 R41 R47 P48 F50 Q54 P56 L57 F58 R59 R60 N68 E90 E98 S99 L3 H4 L6 G11 R13 E15 R18 G20 R21 G22 K29 T30 G32 H35 G37 K39 R41 R47 P48 F50 Q54 P56 L57 F58 R59 R60 N68 E90 E98 S99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5li0, PDBe:5li0, PDBj:5li0
PDBsum5li0
PubMed27906650
UniProtP0A0F8|RL15_STAA8 Large ribosomal subunit protein uL15 (Gene Name=rplO)

[Back to BioLiP]