Structure of PDB 5kli Chain O

Receptor sequence

>5kliO (length=428) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

GIPHDHYEPRTGIEKWLHSRLPIVALAYDTIMIPTPRNLNWMWIWGVVLA
FCLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRNVNGGFMLRYLHANGAS
LFFIAVYLHIFRGLYYGSYKAPREVTWIVGMLIYLAMMATAFMGYVLPWG
QMSFWGATVITGLFGAIPGIGHSIQTWLLGGPAVDNATLNRFFSLHYLLP
FVIAALVAIHIWAFHSTGNNNPTGVEVRRTSKAEAQKDTVPFWPYFIIKD
VFALAVVLLVFFAIVGFMPNYLGHPDNYIEANPLSTPAHIVPEWYFLPFY
AILRAFTADVWVVQIANFISFGIIDAKFFGVLAMFGAILVMALVPWLDTS
PVRSGRYRPMFKIYFWLLAADFVILTWVGAQQTTFPYDWISLIASAYWFA
YFLVILPILGAIEKPVAPPATIEEDFNA

3D structure

PDB

5kli Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.

Chain

Resolution

2.996 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	O	Q58 G62 I63 L65 R94 H97 F104 T142 G146 L149 H198 Y199 P202	Q56 G60 I61 L63 R92 H95 F102 T140 G144 L147 H196 Y197 P200
BS02	HEM	O	W45 G48 L51 F104 H111 R114 S120 R125 W129 G132 M133 H212 F216 N221 N222	W43 G46 L49 F102 H109 R112 S118 R123 W127 G130 M131 H210 F214 N219 N220
BS03	SMA	O	F144 M145 G158 V161 I162 F166 L180 P294 F298 Y302 M336	F142 M143 G156 V159 I160 F164 L178 P292 F296 Y300 M334
BS04	ANJ	O	L41 W45 V49 A52 I213 F216 N221 F244 D252	L39 W43 V47 A50 I211 F214 N219 F242 D250
BS05	LOP	O	L103 L110 Y117 Y118 V262 R358	L101 L108 Y115 Y116 V260 R356

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding

	Biological Process
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5kli, PDBe:5kli, PDBj:5kli
PDBsum	5kli
PubMed	27758861
UniProt	Q02761\|CYB_CERSP Cytochrome b (Gene Name=petB)

[Back to BioLiP]