Structure of PDB 5juo Chain O

Receptor sequence

>5juoO (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

5juo Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	V18 S22 A50 R51 Y52 F57 I59 I65 A66 H68 N95 S97 A98 T99 N101 G103 G105 D107 G124 D126 Y128 V130 K142 K145	V13 S17 A45 R46 Y47 F52 I54 I60 A61 H63 N90 S92 A93 T94 N96 G98 G100 D102 G119 D121 Y123 V125 K137 K140
BS02	rna	O	M9 R10 T44 V46 T70 R72 P134 G135 R137 V138 R140 R141 C144 V148 G149 N150 S151 H152	M4 R5 T39 V41 T65 R67 P129 G130 R132 V133 R135 R136 C139 V143 G144 N145 S146 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5juo, PDBe:5juo, PDBj:5juo
PDBsum	5juo
PubMed	27159452
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]