Structure of PDB 5it9 Chain O

Receptor sequence

>5it9O (length=127) Species: 28985 (Kluyveromyces lactis)

SQVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

• PDB: 5it9 Structural characterization of ribosome recruitment and translocation by type IV IRES.
• Chain: O
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	R18 N24 D25 F27 H29 G35 R36 E37 T38 R41 T43 G45 M46 D51 R52 E54 R90 P122 S123 D124 T126 R127 K128 K129 G130 G131 R132 R133 R135 R136 L137	R8 N14 D15 F17 H19 G25 R26 E27 T28 R31 T33 G35 M36 D41 R42 E44 R80 P112 S113 D114 T116 R117 K118 K119 G120 G121 R122 R123 R125 R126 L127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5it9, PDBe:5it9, PDBj:5it9
• PDBsum: 5it9
• PubMed: 27159451
• UniProt: P27069|RS14_KLULA Small ribosomal subunit protein uS11 (Gene Name=RPS14)