Structure of PDB 5gip Chain O

Receptor sequence
>5gipO (length=227) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREW
NAFRSKLAGAILKGLKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKA
YGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDI
AQPDQTDIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLE
NSNFETIQIINLDPYDKDHAIVLSKYK
3D structure
PDB5gip Box C/D guide RNAs recognize a maximum of 10 nt of substrates
ChainO
Resolution3.129 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O S110 A155 P157 R184 S185 V188 S106 A151 P153 R180 S181 V184
BS02 rna O F57 R58 S87 T89 K182 R184 D220 K221 H223 F53 R54 S83 T85 K178 R180 D216 K217 H219
BS03 SAH O Y82 G84 T90 E108 F109 A134 D153 I154 Q156 Y78 G80 T86 E104 F105 A130 D149 I150 Q152
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008649 rRNA methyltransferase activity
GO:0016740 transferase activity
GO:1990259 histone H2AQ104 methyltransferase activity
Biological Process
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006338 chromatin remodeling
GO:0006364 rRNA processing
GO:0008033 tRNA processing
GO:0031167 rRNA methylation
GO:0032259 methylation
Cellular Component
GO:0031428 box C/D methylation guide snoRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gip, PDBe:5gip, PDBj:5gip
PDBsum5gip
PubMed27625427
UniProtP58032|FLPA_SACS2 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)

[Back to BioLiP]