Structure of PDB 5dm6 Chain O

Receptor sequence
>5dm6O (length=94) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
IQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGEDAGKY
TVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGI
3D structure
PDB5dm6 Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
ChainO
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O G8 K10 R21 E23 S24 R65 K68 Y70 K73 Y74 K75 S76 G77 V78 Y80 R81 R82 R83 T84 G85 H86 R87 Q88 G4 K6 R17 E19 S20 R61 K64 Y66 K69 Y70 K71 S72 G73 V74 Y76 R77 R78 R79 T80 G81 H82 R83 Q84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dm6, PDBe:5dm6, PDBj:5dm6
PDBsum5dm6
PubMed26464437
UniProtQ9RY64|RL21_DEIRA Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]