Structure of PDB 4z0h Chain O

Receptor sequence
>4z0hO (length=333) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
IRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVH
GQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGV
FTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNAS
CTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRA
ASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEK
AATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGI
ALSDKFVKLVSWYDNEWGYSSRVVDLIVHMSKA
3D structure
PDB4z0h Tuning Cysteine Reactivity and Sulfenic Acid Stability by Protein Microenvironment in Glyceraldehyde-3-Phosphate Dehydrogenases of Arabidopsis thaliana.
ChainO
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD O G7 F8 G9 R10 I11 N31 D32 P33 F34 S95 T96 G97 S119 C149 A180 N313 Y317 G7 F8 G9 R10 I11 N31 D32 P33 F34 S97 T98 G99 S121 C151 A182 N315 Y319
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008886 glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:1901149 salicylic acid binding
Biological Process
GO:0006006 glucose metabolic process
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0006979 response to oxidative stress
GO:0009408 response to heat
GO:0009744 response to sucrose
GO:0010154 fruit development
GO:0042542 response to hydrogen peroxide
GO:0045893 positive regulation of DNA-templated transcription
GO:0048316 seed development
GO:0051775 response to redox state
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005740 mitochondrial envelope
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009507 chloroplast
GO:0048046 apoplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z0h, PDBe:4z0h, PDBj:4z0h
PDBsum4z0h
PubMed26650776
UniProtP25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic (Gene Name=GAPC1)

[Back to BioLiP]