Structure of PDB 4x23 Chain O

Receptor sequence
>4x23O (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGIEGGL
3D structure
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
ChainO
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna O R40 Y41 R42 P43 G44 T45 V46 A47 K56 R63 K64 L65 P66 R69 R83 R1 Y2 R3 P4 G5 T6 V7 A8 K17 R24 K25 L26 P27 R30 R44 PDBbind-CN: Kd=0.1uM
BS02 dna O R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 R3 P4 T6 R24 R33 R44 F45 Q46 S47 R77 V78 T79 PDBbind-CN: Kd=0.1uM
BS03 peptide O Q125 R128 R129 G132 G136 L137 Q86 R89 R90 G93 G97 L98
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]