Structure of PDB 4ru2 Chain O

Receptor sequence

>4ru2O (length=110) Species: 10090 (Mus musculus)

PLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKYS
AQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSM
TATQLLVPSR

3D structure

• PDB: 4ru2 Crystal structure of a RNA-binding protein 39 (RBM39) in complex with fragment of splicing factor (U2AF) from Mus musculus at 2.20 A resolution
• Chain: O
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	O	E445 D449 E453 L491 R494 W495 F496 A497 G498 I501 R529	E26 D30 E34 L72 R75 W76 F77 A78 G79 I82 R110

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Biological Process

• GO:0006397 mRNA processing

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4ru2, PDBe:4ru2, PDBj:4ru2
• PDBsum: 4ru2
• UniProt: Q8VH51|RBM39_MOUSE RNA-binding protein 39 (Gene Name=Rbm39)