Structure of PDB 4pyu Chain O

Receptor sequence
>4pyuO (length=75) Species: 9606 (Homo sapiens) [Search protein sequence]
SHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWY
TIFKDHVSLGDYEIHDGMNLELYYQ
3D structure
PDB4pyu The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
ChainO
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide O M1 K17 C18 D21 D22 K29 L30 Q34 M3 K19 C20 D23 D24 K31 L32 Q36
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0031386 protein tag activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0036211 protein modification process
GO:1903955 positive regulation of protein targeting to mitochondrion
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0015030 Cajal body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pyu, PDBe:4pyu, PDBj:4pyu
PDBsum4pyu
PubMed24872507
UniProtQ9BZL1|UBL5_HUMAN Ubiquitin-like protein 5 (Gene Name=UBL5)

[Back to BioLiP]