Structure of PDB 4ioa Chain O

Receptor sequence
>4ioaO (length=94) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
IQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGEDAGKY
TVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGI
3D structure
PDB4ioa Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
ChainO
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O Q6 T7 R21 V22 R65 K68 Y70 I71 K73 Y74 G77 V78 Q79 Y80 R81 R82 R83 G85 H86 R87 Q88 N89 Q2 T3 R17 V18 R61 K64 Y66 I67 K69 Y70 G73 V74 Q75 Y76 R77 R78 R79 G81 H82 R83 Q84 N85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ioa, PDBe:4ioa, PDBj:4ioa
PDBsum4ioa
PubMed23414806
UniProtQ9RY64|RL21_DEIRA Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]