Structure of PDB 4dr4 Chain O

Receptor sequence
>4dr4O (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4dr4 A structural basis for streptomycin-induced misreading of the genetic code.
ChainO
Resolution3.969 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna O P2 K5 K8 F18 D21 T22 G23 S24 Q28 L31 R35 L39 H42 H46 K48 D49 H50 H51 S52 R54 G55 L57 M58 R64 R65 R68 Y69 R72 P1 K4 K7 F17 D20 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 L56 M57 R63 R64 R67 Y68 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4dr4, PDBe:4dr4, PDBj:4dr4
PDBsum4dr4
PubMed23322043
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]