Structure of PDB 3rj1 Chain O

Receptor sequence
>3rj1O (length=94) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
YIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQ
FYERLDKSTTQLRKEIQLLDENVQDTEKMEEQLDLLSAILDPSK
3D structure
PDB3rj1 Architecture of the Mediator head module.
ChainO
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SE O M39 L40 M19 L20
Gene Ontology
Molecular Function
GO:0001097 TFIIH-class transcription factor complex binding
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3rj1, PDBe:3rj1, PDBj:3rj1
PDBsum3rj1
PubMed21725323
UniProtQ99278|MED11_YEAST Mediator of RNA polymerase II transcription subunit 11 (Gene Name=MED11)

[Back to BioLiP]