Structure of PDB 3jd5 Chain O

Receptor sequence

>3jd5O (length=173) Species: 9913 (Bos taurus)

EDDPPPSMLLKDYQNVPGIEKVDDVVKRLISLEMANKKEMLKIKKEQLMS
KVVENPKDTSSLEAQIVALTVKIRSYEEHMQKHQKDKAHKRYLLMSIDKR
QKMLKNLRKTNYPVFEKTCKELGIEYTFPPPYHRKIHRRLATKKALCIRV
FQEVQKLKKQKRALKTAAAAAQK

3D structure

• PDB: 3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
• Chain: O
• Resolution: 7.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	N98 K99 K100 S122 Q127 L131 K134 H141 H145 K147 D148 K149 A150 H151 R153 Y154 L156 M157 K161 K164 Y194 H195 R196 K197 H199 R200 R201 L202 K205 K206 C209 F213 K223 K227	N36 K37 K38 S60 Q65 L69 K72 H79 H83 K85 D86 K87 A88 H89 R91 Y92 L94 M95 K99 K102 Y132 H133 R134 K135 H137 R138 R139 L140 K143 K144 C147 F151 K161 K165

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
• PDBsum: 3jd5
• PubMed: 24799711
• UniProt: P82913|RT15_BOVIN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)