Structure of PDB 3jap Chain O

Receptor sequence
>3japO (length=127) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
SQVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL
3D structure
PDB3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
ChainO
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R18 N24 D25 F27 H29 G35 R36 E37 T38 R41 T43 G45 M46 D51 R52 E54 V121 P122 S123 D124 T126 R127 K129 G130 G131 R132 R135 R136 R8 N14 D15 F17 H19 G25 R26 E27 T28 R31 T33 G35 M36 D41 R42 E44 V111 P112 S113 D114 T116 R117 K119 G120 G121 R122 R125 R126
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jap, PDBe:3jap, PDBj:3jap
PDBsum3jap
PubMed26212456
UniProtP27069|RS14_KLULA Small ribosomal subunit protein uS11 (Gene Name=RPS14)

[Back to BioLiP]