Structure of PDB 3j6b Chain O

Receptor sequence

>3j6bO (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ITIEDKLLQQHIISLQQPEQLASQSLLSPLKREIYEANCKINGGFYKKDT
IVKLPNSSERYKLKLTKREIEVLEPSVYAQSYRIKSSMKKATLLLRLLGG
LDVMKAISQCHFSNKKIAREVAELLQKGVKDGQKLGLKPEDLYISQIWTG
SDGFWRKRVEFKARTRIGIISHPYIHVRCILRTKSVTKRRLAYEAHLKEQ
KRAPWVQLGDKPIRGVTGGVYKW

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	R154 K171 S173 K175 K176 T178 R182 N200 K201 K202 Q232 W234 T235 G236 S237 D238 G239 F247 K248 A249 R250 T251 R252 I253 G254 I255 I256 S257 H258 H262 R264 Q293 R300	R68 K85 S87 K89 K90 T92 R96 N114 K115 K116 Q146 W148 T149 G150 S151 D152 G153 F161 K162 A163 R164 T165 R166 I167 G168 I169 I170 S171 H172 H176 R178 Q207 R214

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P53881\|RM22_YEAST Large ribosomal subunit protein uL22m (Gene Name=MRPL22)

[Back to BioLiP]