Structure of PDB 3cc7 Chain O

Receptor sequence
>3cc7O (length=115) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIER
YAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQ
AIENNPEGSHVRVIR
3D structure
PDB3cc7 Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
ChainO
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O K2 T3 N4 A12 K15 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R50 Y51 K63 L65 G66 S67 G68 S82 S109 H110 V111 R112 I114 R115 K2 T3 N4 A12 K15 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R50 Y51 K63 L65 G66 S67 G68 S82 S109 H110 V111 R112 I114 R115 PDBbind-CN: Kd=1mM
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cc7, PDBe:3cc7, PDBj:3cc7
PDBsum3cc7
PubMed18455733
UniProtP12733|RL18E_HALMA Large ribosomal subunit protein eL18 (Gene Name=rpl18e)

[Back to BioLiP]