Structure of PDB 2yrs Chain O

Receptor sequence

>2yrsO (length=146) Species: 9606 (Homo sapiens)

VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST
PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDP
ENFRLLGNVLVCVLAHHFGKQFTPPVQAAYQKVVAGVANALAHKYH

3D structure

• PDB: 2yrs Human Hemoglobin D Los Angeles: crystal structure
• Chain: O
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	O	L32 F42 F43 H64 K67 V68 A71 L92 H93 L97 N103 F104 L107 L142	L31 F41 F42 H63 K66 V67 A70 L91 H92 L96 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0030492 hemoglobin binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0008217 regulation of blood pressure
• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0030185 nitric oxide transport
• GO:0042542 response to hydrogen peroxide
• GO:0042744 hydrogen peroxide catabolic process
• GO:0045429 positive regulation of nitric oxide biosynthetic process
• GO:0070293 renal absorption
• GO:0070527 platelet aggregation
• GO:0097746 blood vessel diameter maintenance
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005829 cytosol
• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0070062 extracellular exosome
• GO:0071682 endocytic vesicle lumen
• GO:0072562 blood microparticle
• GO:1904724 tertiary granule lumen
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:2yrs, PDBe:2yrs, PDBj:2yrs
• PDBsum: 2yrs
• UniProt: P68871|HBB_HUMAN Hemoglobin subunit beta (Gene Name=HBB)