Structure of PDB 2ykr Chain O

Receptor sequence

>2ykrO (length=88) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]

SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

3D structure

PDB

2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.

Chain

Resolution

9.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	S1 T4 T7 R16 D17 N19 D20 T21 G22 S23 T24 Q27 L30 L38 H41 E44 H45 K46 K47 D48 H49 H50 S51 R52 R53 L56 R57 M58 S60 Q61 R63 K64 L65 Y68 R71 K72 R76	S1 T4 T7 R16 D17 N19 D20 T21 G22 S23 T24 Q27 L30 L38 H41 E44 H45 K46 K47 D48 H49 H50 S51 R52 R53 L56 R57 M58 S60 Q61 R63 K64 L65 Y68 R71 K72 R76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum	2ykr
PubMed	21788480
UniProt	P0ADZ4\|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)