Structure of PDB 2wwa Chain O

Receptor sequence
>2wwaO (length=37) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MAAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRY
3D structure
PDB2wwa Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
ChainO
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O K12 K15 A16 Q19 R21 P22 W26 I27 R30 K12 K15 A16 Q19 R21 P22 W26 I27 R30
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwa, PDBe:2wwa, PDBj:2wwa
PDBsum2wwa
PubMed19933108
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]