Structure of PDB 2wtt Chain O

Receptor sequence

>2wttO (length=41) Species: 9606 (Homo sapiens)

DTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQ

3D structure

• PDB: 2wtt Structural Evolution of P53, P63, and P73: Implication for Heterotetramer Formation.
• Chain: O
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	O	L371 E373 S374 L375 L377 M378 Y389 R390 Q393	L19 E21 S22 L23 L25 M26 Y37 R38 Q41

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006915 apoptotic process
• GO:0051262 protein tetramerization

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:2wtt, PDBe:2wtt, PDBj:2wtt
• PDBsum: 2wtt
• PubMed: 19815500
• UniProt: O15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)