Structure of PDB 2wb1 Chain O

Receptor sequence

>2wb1O (length=64) Species: 2286 (Saccharolobus shibatae)

MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLL
SHIDIISEVIHYTR

3D structure

• PDB: 2wb1 Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
• Chain: O
• Resolution: 3.52 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	O	C7 C10 C44 C45	C7 C10 C44 C45

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2wb1, PDBe:2wb1, PDBj:2wb1
• PDBsum: 2wb1
• PubMed: 19419240
• UniProt: B8YB63|RPO10_SACSH DNA-directed RNA polymerase subunit Rpo10 (Gene Name=rpo10)