Structure of PDB 2uu9 Chain O

Receptor sequence

>2uu9O (length=88) Species: 300852 (Thermus thermophilus HB8)

PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG

3D structure

• PDB: 2uu9 Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
• Chain: O
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	P2 K5 K8 F18 D21 T22 G23 S24 Q28 L31 R35 L39 H42 H46 K48 D49 H50 H51 S52 R54 M58 R64 R65 R68 Y69 R72	P1 K4 K7 F17 D20 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H49 H50 S51 R53 M57 R63 R64 R67 Y68 R71

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2uu9, PDBe:2uu9, PDBj:2uu9
• PDBsum: 2uu9
• PubMed: 17496902
• UniProt: Q5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)