Structure of PDB 2f4v Chain O

Receptor sequence
>2f4vO (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB2f4v Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
ChainO
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O P2 K8 F18 D21 T22 G23 S24 T25 Q28 R35 L39 H42 H46 K48 D49 H50 H51 S52 R54 L57 R64 R65 Y69 P1 K7 F17 D20 T21 G22 S23 T24 Q27 R34 L38 H41 H45 K47 D48 H49 H50 S51 R53 L56 R63 R64 Y68 PDBbind-CN: Kd=2.2uM
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f4v, PDBe:2f4v, PDBj:2f4v
PDBsum2f4v
PubMed16492561
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]