Structure of PDB 1ywh Chain O

Receptor sequence
>1ywhO (length=258) Species: 9606 (Homo sapiens) [Search protein sequence]
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEK
TNRTLSYRTGLKITSLTEVVCGLDLCNQGNSYLECISCGSSDMSCERGRH
QSLQCRSPEEQCLDVVTHWIQDDRHLRGCGYLPGCPGSNGFHNNDTFHFL
KCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTK
SGCNHPDL
3D structure
PDB1ywh Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
ChainO
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide O R2 M4 V14 E16 D74 L75 C76 Q78 R2 M4 V14 E16 D74 L75 C76 Q78
BS02 peptide O T27 V29 R53 T54 L55 Y57 L66 S100 V125 R142 L150 H251 D254 A255 S257 N259 T27 V29 R53 T54 L55 Y57 L66 S90 V115 R124 L132 H233 D236 A237 S239 N241
BS03 FUC O S117 E119 S107 E109
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0030377 urokinase plasminogen activator receptor activity
GO:0038023 signaling receptor activity
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007596 blood coagulation
GO:0010755 regulation of plasminogen activation
GO:0030155 regulation of cell adhesion
GO:0030162 regulation of proteolysis
GO:0034112 positive regulation of homotypic cell-cell adhesion
GO:0038195 urokinase plasminogen activator signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0043388 positive regulation of DNA binding
GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway
GO:0051917 regulation of fibrinolysis
GO:0090200 positive regulation of release of cytochrome c from mitochondria
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
GO:2001268 negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
Cellular Component
GO:0005576 extracellular region
GO:0005788 endoplasmic reticulum lumen
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0019898 extrinsic component of membrane
GO:0035579 specific granule membrane
GO:0042995 cell projection
GO:0070161 anchoring junction
GO:0098552 side of membrane
GO:0098637 protein complex involved in cell-matrix adhesion
GO:1905370 serine-type endopeptidase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ywh, PDBe:1ywh, PDBj:1ywh
PDBsum1ywh
PubMed15861141
UniProtQ03405|UPAR_HUMAN Urokinase plasminogen activator surface receptor (Gene Name=PLAUR)

[Back to BioLiP]