Structure of PDB 1yjw Chain O

Receptor sequence

>1yjwO (length=115) Species: 2238 (Haloarcula marismortui)

SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIER
YAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQ
AIENNPEGSHVRVIR

3D structure

• PDB: 1yjw Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
• Chain: O
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	S1 K2 T3 N4 A12 K15 S16 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R47 R50 Y51 K63 L65 G66 S67 G68 S82 T84 S109 H110 V111 R112 V113 I114 R115	S1 K2 T3 N4 A12 K15 S16 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R47 R50 Y51 K63 L65 G66 S67 G68 S82 T84 S109 H110 V111 R112 V113 I114 R115

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1yjw, PDBe:1yjw, PDBj:1yjw
• PDBsum: 1yjw
• PubMed: 15851032
• UniProt: P12733|RL18E_HALMA Large ribosomal subunit protein eL18 (Gene Name=rpl18e)