Structure of PDB 1xbp Chain O |
>1xbpO (length=117) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] |
PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRR NKKRDFRRLWIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAR EPEAFKALVDASRNARQ |
|
PDB | 1xbp Inhibition of peptide bond formation by pleuromutilins: the structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with tiamulin. |
Chain | O |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
O |
P2 G7 Q31 T38 |
P1 G6 Q30 T37 |
|
|
|
|