Structure of PDB 1vqp Chain O

Receptor sequence

>1vqpO (length=115) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIER
YAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQ
AIENNPEGSHVRVIR

3D structure

PDB

1vqp Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.

Chain

Resolution

2.25 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	S1 K2 T3 N4 A12 K15 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R47 R50 Y51 K63 L65 G66 S67 G68 S82 S109 H110 V111 R112 V113 I114 R115	S1 K2 T3 N4 A12 K15 R19 A24 V25 D28 K35 P36 R37 R38 E42 N44 R47 R50 Y51 K63 L65 G66 S67 G68 S82 S109 H110 V111 R112 V113 I114 R115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1vqp, PDBe:1vqp, PDBj:1vqp
PDBsum	1vqp
PubMed	16285925
UniProt	P12733\|RL18E_HALMA Large ribosomal subunit protein eL18 (Gene Name=rpl18e)