Structure of PDB 1vf5 Chain O

Receptor sequence
>1vf5O (length=138) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPAN
PFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENV
NKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL
3D structure
PDB1vf5 Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
ChainO
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide O L18 V43 A49 C50 L54 L57 L1 V26 A32 C33 L37 L40
BS02 HEM O F40 V43 I44 F23 V26 I27
BS03 TDS O P77 L81 P60 L64
BS04 CLA O Y80 P83 V84 V104 P105 L106 I132 F133 G136 T140 Y63 P66 V67 V87 P88 L89 I115 F116 G119 T123
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vf5, PDBe:1vf5, PDBj:1vf5
PDBsum1vf5
PubMed14526088
UniProtP83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)

[Back to BioLiP]