Structure of PDB 1n36 Chain O

Receptor sequence

>1n36O (length=88) Species: 274 (Thermus thermophilus)

PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG

3D structure

• PDB: 1n36 Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
• Chain: O
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	P2 K5 K8 F18 D21 T22 G23 S24 Q28 L31 R35 L39 H42 H46 D49 H51 S52 R54 G55 L57 M58 R65 Y69 R72	P1 K4 K7 F17 D20 T21 G22 S23 Q27 L30 R34 L38 H41 H45 D48 H50 S51 R53 G54 L56 M57 R64 Y68 R71	PDBbind-CN: Kd=150uM

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1n36, PDBe:1n36, PDBj:1n36
• PDBsum: 1n36
• PubMed: 12464183
• UniProt: Q5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)