Structure of PDB 1iw7 Chain O

Receptor sequence

>1iw7O (length=95) Species: 274 (Thermus thermophilus)

AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTL
EGLFDDPNAETWAMKELLTGRLVFGENLVPEDRLQKEMERIYPGE

3D structure

• PDB: 1iw7 Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
• Chain: O
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	O	L54 N59 T62	L53 N58 T61
BS02	MG	O	K47 M48 Q49	K46 M47 Q48

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex

External links

• PDB: RCSB:1iw7, PDBe:1iw7, PDBj:1iw7
• PDBsum: 1iw7
• PubMed: 12000971
• UniProt: Q8RQE7|RPOZ_THET8 DNA-directed RNA polymerase subunit omega (Gene Name=rpoZ)