Structure of PDB 8fl4 Chain NZ

Receptor sequence
>8fl4NZ (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]
VIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDF
ARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKK
KQLRSIEKRDTLALLQK
3D structure
PDB8fl4 Principles of human pre-60 S biogenesis.
ChainNZ
Resolution2.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna NZ G238 S242 R244 W246 K247 K251 K252 R253 F254 S255 Q259 T265 W267 K270 R274 Q320 K327 K329 R330 K333 Q335 G5 S9 R11 W13 K14 K18 K19 R20 F21 S22 Q26 T32 W34 K37 R41 Q87 K94 K96 R97 K100 Q102
BS02 rna NZ R301 R302 N305 R309 N312 A316 R68 R69 N72 R76 N79 A83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8fl4, PDBe:8fl4, PDBj:8fl4
PDBsum8fl4
PubMed37410842
UniProtQ9H6F5|CCD86_HUMAN Coiled-coil domain-containing protein 86 (Gene Name=CCDC86)

[Back to BioLiP]