Structure of PDB 8fl3 Chain NZ

Receptor sequence

>8fl3NZ (length=117) Species: 9606 (Homo sapiens)

VIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDF
ARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKK
KQLRSIEKRDTLALLQK

3D structure

• PDB: 8fl3 Principles of human pre-60 S biogenesis.
• Chain: NZ
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NZ	K237 G238 S242 R244 W246 K247 K251 K252 R253 F254 S255 Q259 T265 W267 K270 R274 K327 K329 R330 K332 K333 Q335	K4 G5 S9 R11 W13 K14 K18 K19 R20 F21 S22 Q26 T32 W34 K37 R41 K94 K96 R97 K99 K100 Q102
BS02	rna	NZ	R301 R302 N305 R309 N312 E313 A316	R68 R69 N72 R76 N79 E80 A83

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus

External links

• PDB: RCSB:8fl3, PDBe:8fl3, PDBj:8fl3
• PDBsum: 8fl3
• PubMed: 37410842
• UniProt: Q9H6F5|CCD86_HUMAN Coiled-coil domain-containing protein 86 (Gene Name=CCDC86)