Structure of PDB 8fl0 Chain NZ

Receptor sequence
>8fl0NZ (length=49) Species: 9606 (Homo sapiens) [Search protein sequence]
VIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKD
3D structure
PDB8fl0 Principles of human pre-60 S biogenesis.
ChainNZ
Resolution2.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna NZ K237 G238 S242 R244 K247 R249 K251 K252 R253 F254 S255 Q256 R264 W267 Q268 K270 R274 K4 G5 S9 R11 K14 R16 K18 K19 R20 F21 S22 Q23 R31 W34 Q35 K37 R41
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
PDBsum8fl0
PubMed37410842
UniProtQ9H6F5|CCD86_HUMAN Coiled-coil domain-containing protein 86 (Gene Name=CCDC86)

[Back to BioLiP]