Structure of PDB 8fkt Chain NS

Receptor sequence

>8fktNS (length=305) Species: 9606 (Homo sapiens)

AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
KAPPKPVPKTIDNQRVYDETTVDPNDEEVAYDEATDEFASYFNKQTSPKI
LITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLALKKIIPQCIARDFTD
LIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPTEHIP
EIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHR
YIFRSEKKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSR
RKFHL

3D structure

• PDB: 8fkt Principles of human pre-60 S biogenesis.
• Chain: NS
• Resolution: 2.81 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NS	G51 F52	G7 F8
BS02	rna	NS	P49 P50 S55 K58 N59 K60 Q61 R62 R63 H64 F67 W70 R75 P100 P102 K103 T104 I105 R151 P152 H153 V157 Y174 R202 K203 R338 R344 R345	P5 P6 S11 K14 N15 K16 Q17 R18 R19 H20 F23 W26 R31 P56 P58 K59 T60 I61 R107 P108 H109 V113 Y130 R158 K159 R294 R300 R301

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0042134 rRNA primary transcript binding

Biological Process

• GO:0000460 maturation of 5.8S rRNA
• GO:0000470 maturation of LSU-rRNA
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:8fkt, PDBe:8fkt, PDBj:8fkt
• PDBsum: 8fkt
• PubMed: 37410842
• UniProt: Q9H9Y2|RPF1_HUMAN Ribosome production factor 1 (Gene Name=RPF1)