Structure of PDB 8fld Chain NP

Receptor sequence

>8fldNP (length=108) Species: 9606 (Homo sapiens)

RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRFDPDLPGGGLHRCLAC
ARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRR
LAVPTEVS

3D structure

• PDB: 8fld Principles of human pre-60S biogenesis
• Chain: NP
• Resolution: 2.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NP	R3 S4 R5 R6 T7 G8 A9 H10 R11 A12 H13 L15 R17 K20 A21 R23 R68 I71 N75 K83 D84 K87 Q91	R1 S2 R3 R4 T5 G6 A7 H8 R9 A10 H11 L13 R15 K18 A19 R21 R52 I55 N59 K67 D68 K71 Q75
BS02	ZN	NP	C66 H79 H85	C50 H63 H69

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0042254 ribosome biogenesis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8fld, PDBe:8fld, PDBj:8fld
• PDBsum: 8fld
• PubMed: 37410842
• UniProt: O00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)