Structure of PDB 8flb Chain NP

Receptor sequence

>8flbNP (length=104) Species: 9606 (Homo sapiens)

RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRFDPDLPGGGLHRCLAC
ARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRR
LAVP

3D structure

• PDB: 8flb Principles of human pre-60 S biogenesis.
• Chain: NP
• Resolution: 2.55 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NP	R3 S4 R5 R6 T7 A9 H10 R11 A12 H13 S14 L15 R17 K20 A21 R23 R68 F70 N75 T78 K83 D84 K87	R1 S2 R3 R4 T5 A7 H8 R9 A10 H11 S12 L13 R15 K18 A19 R21 R52 F54 N59 T62 K67 D68 K71
BS02	ZN	NP	C66 H79 H85	C50 H63 H69

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0042254 ribosome biogenesis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8flb, PDBe:8flb, PDBj:8flb
• PDBsum: 8flb
• PubMed: 37410842
• UniProt: O00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)